Cosmetic Peptide P21 Synthesis 98% Peptides AC-Dggl-Nh2 Powder

• CAS No.: /
• Formula: /
• EINECS: /
• Type: Synthesis Material Intermediates
• Appearance: Powder
• Quality: Refined
• Model NO.: SWY-P21
• Colour: White
• Transport Package: Box
• Specification: 10 VIALS /BOX
• Origin: Shaanxi
• Production Capacity: 50000box/Month

Product Description

CAS	1159861-00-3
M.W/Mr.	4029.2
Purity	99%
Sequence	PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

Q1: Do you have stock?
A: We understand most customers prefer stock, so we'll try to keep stock for most products. However, for some rare products,
wewon't keep stock and it needs time to synthesize.

Q2: What certificates and documents do you offer?
A: Some technical paperwork is available, such as COA, HNMR, HPLC, LC-MS etc.

Q3: Why should I choose you?
A: Powerful technical support-come from our highly skilled & fully experienced staff, working in chemical industry for over
5years, in average.Strict quality control-comes form our sophisticated management system.Professional and warm sales team-since we
believe we can only win via our hard work in a competitive worldQuick response and excellent presale and after sale service-since
we believe our customers deserve all the best service.

Q4: Can I get best price from you?
A: Of course. We don't chase excessive profits and always try tp give best offer. If you are good at bargaining, you can alsoenjoy
fun of bargaining. Just don't make it too hard!

Q5: How should I pay?
A: We accept all kinds of payment ways. such as alibaba trade asssurance, T/T, West union, MoneyGram.